Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYP3A7 Rabbit Polyclonal Antibody (HRP)

CYP3A7 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CP37, CYPIIIA7, P450HLp2, P450-HFLA, P-450111A7, P-450 (HFL33)

UniProt

P24462

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CYP3A7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KSVKQIKEGRLKETQKHRVDFLQLMIDSQNSKDSETHKALSDLELMAQSI

Field of Research

Metabolism Research

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Rat

Tested Applications

WB

NCBI Accession Number

NP_000756

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GDPD3 Lentiviral Activation Particles (h2)
sc-405288-LAC-2 200 µL

GDPD3 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
Mmu-miR-465a-5p miRNA Agomir
CMN0226-01 5 nmol

Mmu-miR-465a-5p miRNA Agomir

Sign In for Pricing
View Details
Mmu-miR-465a-5p miRNA Agomir
CMN0226-02 10 nmol

Mmu-miR-465a-5p miRNA Agomir

Sign In for Pricing
View Details
Mmu-miR-465a-5p miRNA Agomir
CMN0226-03 20 nmol

Mmu-miR-465a-5p miRNA Agomir

Sign In for Pricing
View Details
CHD7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K0443306 1.0 µg DNA

CHD7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Fmr1 Mouse siRNA Oligo Duplex (Locus ID 14265)
SR418195 1 Kit

Fmr1 Mouse siRNA Oligo Duplex (Locus ID 14265)

Sign In for Pricing
View Details