Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYP3A7 Rabbit Polyclonal Antibody (Biotin)

CYP3A7 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CP37, CYPIIIA7, P450HLp2, P450-HFLA, P-450111A7, P-450 (HFL33)

UniProt

P24462

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CYP3A7

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KLALVRVLQNFSFKPCKETQIPLKLRFGGLLLTEKPIVLKAESRDETVSG

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human

Tested Applications

WB

NCBI Accession Number

NP_000756

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HIST1H2AM sgRNA CRISPR Lentivector (Human) (Target 2)
K0955503 1.0 µg DNA

HIST1H2AM sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Mapk8 (NM_016700) Mouse Tagged Lenti ORF Clone
MR206802L3 10 µg

Mapk8 (NM_016700) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Human TPP1 (Tripeptidyl Peptidase I) ELISA Kit
MBS8802828-01 48 Well

Human TPP1 (Tripeptidyl Peptidase I) ELISA Kit

Sign In for Pricing
View Details
Human TPP1 (Tripeptidyl Peptidase I) ELISA Kit
MBS8802828-02 96 Well

Human TPP1 (Tripeptidyl Peptidase I) ELISA Kit

Sign In for Pricing
View Details
Human TPP1 (Tripeptidyl Peptidase I) ELISA Kit
MBS8802828-03 5x 96 Well

Human TPP1 (Tripeptidyl Peptidase I) ELISA Kit

Sign In for Pricing
View Details
Human TPP1 (Tripeptidyl Peptidase I) ELISA Kit
MBS8802828-04 10x 96 Well

Human TPP1 (Tripeptidyl Peptidase I) ELISA Kit

Sign In for Pricing
View Details