Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYP2C18 Rabbit Polyclonal Antibody (Biotin)

CYP2C18 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CPCI, CYP2C, CYP2C17, P450IIC17, P450-6B/29C

UniProt

P33260

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CYP2C18

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MDPAVALVLCLSCLFLLSLWRQSSGRGRLPSGPTPLPIIGNILQLDVKDM

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_000763

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRRK2 Protein (N-GST, Human)
P526494 100 µg

LRRK2 Protein (N-GST, Human)

Sign In for Pricing
View Details
Human CTSL/Cathepsin L1 ELISA Kit
orb1662183 96 Tests

Human CTSL/Cathepsin L1 ELISA Kit

Sign In for Pricing
View Details
RGD1563669 Protein Vector (Rat) (pPM-C-His)
PV300757 500 ng

RGD1563669 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Anti-Human ROR1/NTRKR1 Monoclonal Antibody (R12), PerCP
PTX23271 100 µg

Anti-Human ROR1/NTRKR1 Monoclonal Antibody (R12), PerCP

Sign In for Pricing
View Details
Leucine Rich Repeat In FLII Interacting Protein 1 (LRRFIP1) Magnetic Fluorescence Assay Kit
MBS2160876-01 96 Tests

Leucine Rich Repeat In FLII Interacting Protein 1 (LRRFIP1) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Leucine Rich Repeat In FLII Interacting Protein 1 (LRRFIP1) Magnetic Fluorescence Assay Kit
MBS2160876-02 5x 96 Tests

Leucine Rich Repeat In FLII Interacting Protein 1 (LRRFIP1) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details