Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PON3 Rabbit Polyclonal Antibody (HRP)

PON3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q15166

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PON3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PMKLLNYNPEDPPGSEVLRIQNVLSEKPRVSTVYANNGSVLQGTSVASVY

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_000931

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C18 Sorbent (Unendcapped) - 100g/bottle
SPESORB0C18N1100A 1 Piece/Case:1 Piece/ PACKS:1 PACKS/CASE

C18 Sorbent (Unendcapped) - 100g/bottle

Sign In for Pricing
View Details
Rabbit anti-human Forkhead box protein P1 polyclonal Antibody, HRP conjugated
MBS1490152-01 0.05 mg

Rabbit anti-human Forkhead box protein P1 polyclonal Antibody, HRP conjugated

Sign In for Pricing
View Details
Rabbit anti-human Forkhead box protein P1 polyclonal Antibody, HRP conjugated
MBS1490152-02 0.1 mg

Rabbit anti-human Forkhead box protein P1 polyclonal Antibody, HRP conjugated

Sign In for Pricing
View Details
Rabbit anti-human Forkhead box protein P1 polyclonal Antibody, HRP conjugated
MBS1490152-03 5x 0.1 mg

Rabbit anti-human Forkhead box protein P1 polyclonal Antibody, HRP conjugated

Sign In for Pricing
View Details
AIR2 Antibody
orb844167 2 mg

AIR2 Antibody

Sign In for Pricing
View Details
ASB1 Protein Vector (Rat) (pPM-C-HA)
PV254824 500 ng

ASB1 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details