Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLK2 Rabbit Polyclonal Antibody (Biotin)

KLK2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HK2, hGK-1, KLK2A2

UniProt

P20151

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human KLK2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_001002231

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM87A ORF Vector (Human) (pORF)
ORF010763 1.0 µg DNA

TMEM87A ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Recombinant Human Chloride intracellular channel protein 3 protein (C-6His)
CD02039-01 10 µg

Recombinant Human Chloride intracellular channel protein 3 protein (C-6His)

Sign In for Pricing
View Details
Recombinant Human Chloride intracellular channel protein 3 protein (C-6His)
CD02039-02 50 µg

Recombinant Human Chloride intracellular channel protein 3 protein (C-6His)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Galectin 12 (GAL12)
MBS2040992-01 0.1 mL

FITC-Linked Polyclonal Antibody to Galectin 12 (GAL12)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Galectin 12 (GAL12)
MBS2040992-02 0.2 mL

FITC-Linked Polyclonal Antibody to Galectin 12 (GAL12)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Galectin 12 (GAL12)
MBS2040992-03 0.5 mL

FITC-Linked Polyclonal Antibody to Galectin 12 (GAL12)

Sign In for Pricing
View Details