Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EEF1AKNMT Rabbit Polyclonal Antibody (FITC)

EEF1AKNMT Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Feat, DFNM1, CGI-01, DFNB26, DFNB26M, METTL13, KIAA0859, 5630401D24Rik

UniProt

Q8N6R0

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human KIAA0859

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: NEILFCQLHPEQKLATPELLETAQALERTLRKPGRGWDDTYVLSDMLKTV

Field of Research

Epigenetics & Chromatin

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001007240

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RFC2 ORF Vector (Human) (pORF)
ORF028887 1.0 µg DNA

RFC2 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Anti-S1 (Bat coronavirus HKU4-2)
IT-002-020M3-01 0.1 mg

Anti-S1 (Bat coronavirus HKU4-2)

Sign In for Pricing
View Details
Anti-S1 (Bat coronavirus HKU4-2)
IT-002-020M3-02 0.5 mg

Anti-S1 (Bat coronavirus HKU4-2)

Sign In for Pricing
View Details
Lentiviral mouse Flrt2 shRNA (UAS) - Lentiviral mouse Flrt2 shRNA (UAS, iRFP) (25)
GTR15299345 1 Vial

Lentiviral mouse Flrt2 shRNA (UAS) - Lentiviral mouse Flrt2 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
RGD1559629 3'UTR Luciferase Stable Cell Line
TU218053 1.0 mL

RGD1559629 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Macrophage Inflammatory Protein 3 beta, Human (MIP-3b, Exodus-3, ELC) (FITC)
MBS6486025-01 0.1 mL

Macrophage Inflammatory Protein 3 beta, Human (MIP-3b, Exodus-3, ELC) (FITC)

Sign In for Pricing
View Details