Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EEF1AKNMT Rabbit Polyclonal Antibody (HRP)

EEF1AKNMT Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Feat, DFNM1, CGI-01, DFNB26, DFNB26M, METTL13, KIAA0859, 5630401D24Rik

UniProt

Q8N6R0

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human KIAA0859

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NEILFCQLHPEQKLATPELLETAQALERTLRKPGRGWDDTYVLSDMLKTV

Field of Research

Epigenetics & Chromatin

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001007240

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SUMF1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
45865066 1.0 µg DNA

SUMF1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Frizzled 4/FZD4 Rabbit Polyclonal Antibody
orb402495 100 µg

Frizzled 4/FZD4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Defb4, Recombinant, Mouse, aa23-63, His-SUMO-Tag (Beta-defensin 4)
373031-01 20 µg

Defb4, Recombinant, Mouse, aa23-63, His-SUMO-Tag (Beta-defensin 4)

Sign In for Pricing
View Details
Defb4, Recombinant, Mouse, aa23-63, His-SUMO-Tag (Beta-defensin 4)
373031-02 100 µg

Defb4, Recombinant, Mouse, aa23-63, His-SUMO-Tag (Beta-defensin 4)

Sign In for Pricing
View Details
Rabbit Polyclonal PPRC1 Antibody
NBP2-55822 100 µL

Rabbit Polyclonal PPRC1 Antibody

Sign In for Pricing
View Details
Human Alternative macrophage activation associated CC chemokine 1 ELISA Kit
MBS725015-01 48 Strip Well

Human Alternative macrophage activation associated CC chemokine 1 ELISA Kit

Sign In for Pricing
View Details