Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYP4A22 Rabbit Polyclonal Antibody (FITC)

CYP4A22 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q5TCH4

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CYP4A22

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: AQLYLHRQWLLKALQQFPCPPSHWLFGHIQEFQHDQELQRIQERVKTFPS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_001010969

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fat1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6997005 3x 1.0 µg

Fat1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Lentiviral mouse Clpx shRNA (UAS) - Lentiviral mouse Clpx shRNA (UAS, GFP) (100)
GTR15198189 1 Vial

Lentiviral mouse Clpx shRNA (UAS) - Lentiviral mouse Clpx shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Human Pro Brain Derived Neurotrophic Factor, PRO-BDNF ELISA KIT
E4070hu-01 48 Well

Human Pro Brain Derived Neurotrophic Factor, PRO-BDNF ELISA KIT

Sign In for Pricing
View Details
Human Pro Brain Derived Neurotrophic Factor, PRO-BDNF ELISA KIT
E4070hu-02 96 Well

Human Pro Brain Derived Neurotrophic Factor, PRO-BDNF ELISA KIT

Sign In for Pricing
View Details
Human Pro Brain Derived Neurotrophic Factor, PRO-BDNF ELISA KIT
E4070hu-03 5x 96 Tests

Human Pro Brain Derived Neurotrophic Factor, PRO-BDNF ELISA KIT

Sign In for Pricing
View Details
Human Pro Brain Derived Neurotrophic Factor, PRO-BDNF ELISA KIT
E4070hu-04 10x 96 Tests

Human Pro Brain Derived Neurotrophic Factor, PRO-BDNF ELISA KIT

Sign In for Pricing
View Details