Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DHODH Rabbit Polyclonal Antibody (HRP)

DHODH Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

URA1, POADS, DHOdehase

UniProt

Q02127

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human DHODH

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLG

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001352

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) ; Clone CD30/412 (Concentrate)
RA0048-C.5 0.5 mL

CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) ; Clone CD30/412 (Concentrate)

Sign In for Pricing
View Details
hsa-miR-6874-3p miRNA Mimic
MCH03705 2x 2.5 nmol

hsa-miR-6874-3p miRNA Mimic

Sign In for Pricing
View Details
PRG3 siRNA (Mouse)
CRM5402-01 15 nmol

PRG3 siRNA (Mouse)

Sign In for Pricing
View Details
PRG3 siRNA (Mouse)
CRM5402-02 30 nmol

PRG3 siRNA (Mouse)

Sign In for Pricing
View Details
SLS Coverslips No 1 24x40mm
MIC3232 100 / PCK

SLS Coverslips No 1 24x40mm

Sign In for Pricing
View Details
EPHB3/Eph receptor B3 Recombinant Antibody, Biotin Conjugated
bsm-62350R-Biotin-TR 20 µL

EPHB3/Eph receptor B3 Recombinant Antibody, Biotin Conjugated

Sign In for Pricing
View Details