Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DHODH Rabbit Polyclonal Antibody (Biotin)

DHODH Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

URA1, POADS, DHOdehase

UniProt

Q02127

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human DHODH

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNS

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001352

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human MSLN Protein, Fc-tagged, Alexa Fluor 555 conjugated
MSLN-8558HAF555 20 μg- 50 μg- 100 μg

Recombinant Human MSLN Protein, Fc-tagged, Alexa Fluor 555 conjugated

Sign In for Pricing
View Details
Transketolase/TKT Mouse Monoclonal Antibody (HRP)
orb2602938 100 µg

Transketolase/TKT Mouse Monoclonal Antibody (HRP)

Sign In for Pricing
View Details
IDI1 (Isopentenyl-Diphosphate Delta-isomerase 1)
483295 100 µL

IDI1 (Isopentenyl-Diphosphate Delta-isomerase 1)

Sign In for Pricing
View Details
Anti-DUXA Antibody Picoband® PE Conjugated
A17132-1-PE 100 µg/Vial

Anti-DUXA Antibody Picoband® PE Conjugated

Sign In for Pricing
View Details
Tnfrsf26 shRNA Plasmid (m)
sc-154539-SH 20 µg

Tnfrsf26 shRNA Plasmid (m)

Sign In for Pricing
View Details
Human Mucin-7, MUC7 ELISA KIT
E1613Hu-01 48 Well

Human Mucin-7, MUC7 ELISA KIT

Sign In for Pricing
View Details