Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALOX15B Rabbit Polyclonal Antibody (HRP)

ALOX15B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

15-LOX-2

UniProt

O15296

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ALOX15B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ATCEGFIATLPPVNATCDVILALWLLSKEPGDQRPLGTYPDEHFTEEAPR

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

74kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001132

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR176 (NM_001271854) Human Tagged ORF Clone
RG234325 10 µg

GPR176 (NM_001271854) Human Tagged ORF Clone

Sign In for Pricing
View Details
Optineurin Polyclonal Antibody, FITC Conjugated
bs-13658R-FITC 100 µL

Optineurin Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
RCC2 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
38734154 3x 1.0 µg DNA

RCC2 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
Rat NNAT shRNA Plasmid
abx987095-01 150 µg

Rat NNAT shRNA Plasmid

Sign In for Pricing
View Details
Rat NNAT shRNA Plasmid
abx987095-02 300 µg

Rat NNAT shRNA Plasmid

Sign In for Pricing
View Details
Anti-B-cell linker protein BLNK Monoclonal Antibody
M03630-1 100 µL

Anti-B-cell linker protein BLNK Monoclonal Antibody

Sign In for Pricing
View Details