Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C9orf127 Rabbit Polyclonal Antibody (HRP)

C9orf127 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NAG5, NGX6, FP588, NAG-5, NGX6a, C9orf127, LINC00950

UniProt

Q9HBY2

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human C9orf127

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MNMPQSLGNQPLPPEPPSLGTPAEGPGTTSPPEHCWPVRPTLRNELDTFS

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_057530

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal LSP1 Antibody [DyLight 488]
NBP1-74048G 0.1 mL

Rabbit Polyclonal LSP1 Antibody [DyLight 488]

Sign In for Pricing
View Details
Cyclin A2 (46B11) Alexa Fluor® 790
sc-53234 AF790 200 µg/mL

Cyclin A2 (46B11) Alexa Fluor® 790

Sign In for Pricing
View Details
HCLS1 (Hematopoietic Cell-Specific Lyn Substrate 1, CTTNL, HS1)
246945 50 µL

HCLS1 (Hematopoietic Cell-Specific Lyn Substrate 1, CTTNL, HS1)

Sign In for Pricing
View Details
SALL2 Human shRNA Plasmid Kit (Locus ID 6297)
TL309657 1 Kit

SALL2 Human shRNA Plasmid Kit (Locus ID 6297)

Sign In for Pricing
View Details
ATP9A Protein Vector (Human) (pPM-N-D-C-HA)
PV325612 500 ng

ATP9A Protein Vector (Human) (pPM-N-D-C-HA)

Sign In for Pricing
View Details
HECT E3 ubiquitin ligase Rabbit Polyclonal Antibody (PE)
orb487062 100 µL

HECT E3 ubiquitin ligase Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details