Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C9orf127 Rabbit Polyclonal Antibody (FITC)

C9orf127 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

NAG5, NGX6, FP588, NAG-5, NGX6a, C9orf127, LINC00950

UniProt

Q5TCW5

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human C9orf127

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: FLLPPRAKTDHGVPSGARARGCGYQLCINEQEELGLVGPGGATVSSICAS

Field of Research

Cell Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001036054

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chorionic Gonadotropin, Human, beta (hCGb) discontinued. See C5069-89
C5069-89A 100 µg

Chorionic Gonadotropin, Human, beta (hCGb) discontinued. See C5069-89

Sign In for Pricing
View Details
Resorufin alpha-D-galactopyranoside
14021-AAT 5 mg

Resorufin alpha-D-galactopyranoside

Sign In for Pricing
View Details
Mouse Monoclonal human Orexin R2 Antibody
orb1409610-01 100 µg

Mouse Monoclonal human Orexin R2 Antibody

Sign In for Pricing
View Details
Mouse Monoclonal human Orexin R2 Antibody
orb1409610-02 50 µg

Mouse Monoclonal human Orexin R2 Antibody

Sign In for Pricing
View Details
Benzothiazol-2-yl- (tetrahydro-furan-2-ylmethyl) -amine
sc-353044 1 g

Benzothiazol-2-yl- (tetrahydro-furan-2-ylmethyl) -amine

Sign In for Pricing
View Details
Rat Fbl Pre-designed siRNA Set A
SI204899A 1 Each

Rat Fbl Pre-designed siRNA Set A

Sign In for Pricing
View Details