Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sst Rabbit Polyclonal Antibody (FITC)

Sst Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

S, SS, Sm, SOM, SRIF, Smst

UniProt

P60041

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LQKSLAAATGKQELAKYFLAELLSEPNQTENDALEPEDLPQAAEQDEMRL

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

13kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_033241

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD43 (T-Cell Marker) (rSPN/1094), CF647 conjugate, 0.1mg/mL
BNC471858-500 1x 500 µL

CD43 (T-Cell Marker) (rSPN/1094), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
M6A Monoclonal Antibody
E-AB-48030-01 25 µL

M6A Monoclonal Antibody

Sign In for Pricing
View Details
M6A Monoclonal Antibody
E-AB-48030-02 100 µL

M6A Monoclonal Antibody

Sign In for Pricing
View Details
Mouse CD48 (Cluster Of Differentiation 48) ELISA Kit
E-EL-M3116-01 24 Tests

Mouse CD48 (Cluster Of Differentiation 48) ELISA Kit

Sign In for Pricing
View Details
Mouse CD48 (Cluster Of Differentiation 48) ELISA Kit
E-EL-M3116-02 48 Tests

Mouse CD48 (Cluster Of Differentiation 48) ELISA Kit

Sign In for Pricing
View Details
Mouse CD48 (Cluster Of Differentiation 48) ELISA Kit
E-EL-M3116-03 96 Tests

Mouse CD48 (Cluster Of Differentiation 48) ELISA Kit

Sign In for Pricing
View Details