Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACTN3 Rabbit Polyclonal Antibody (FITC)

ACTN3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ACTN3D

UniProt

Q08043

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ACTN3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VQNFHTSWKDGLALCALIHRHRPDLIDYAKLRKDDPIGNLNTAFEVAEKY

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

103kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_001095

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human NOXRED1 Pre-designed siRNA Set A
SI010708A 1 Each

Human NOXRED1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Beta-Amyloid (1-42) Mouse Monoclonal Antibody (BF750)
orb2363306 100 µL

Beta-Amyloid (1-42) Mouse Monoclonal Antibody (BF750)

Sign In for Pricing
View Details
Prkce (NM_011104) Mouse Recombinant Protein
PM42647M5 20 µg

Prkce (NM_011104) Mouse Recombinant Protein

Sign In for Pricing
View Details
MDM4 (MDMX, Protein Mdm4, Protein Mdmx, Double Minute 4 Protein, Mdm2-like p53-binding Protein, p53-binding Protein Mdm4, MGC132766, MRP1) (AP)
MBS6385148-01 0.1 mL

MDM4 (MDMX, Protein Mdm4, Protein Mdmx, Double Minute 4 Protein, Mdm2-like p53-binding Protein, p53-binding Protein Mdm4, MGC132766, MRP1) (AP)

Sign In for Pricing
View Details
MDM4 (MDMX, Protein Mdm4, Protein Mdmx, Double Minute 4 Protein, Mdm2-like p53-binding Protein, p53-binding Protein Mdm4, MGC132766, MRP1) (AP)
MBS6385148-02 5x 0.1 mL

MDM4 (MDMX, Protein Mdm4, Protein Mdmx, Double Minute 4 Protein, Mdm2-like p53-binding Protein, p53-binding Protein Mdm4, MGC132766, MRP1) (AP)

Sign In for Pricing
View Details
DDAH1 (N (G), N (G) -dimethylarginine Dimethylaminohydrolase 1, DDAH-1, Dimethylarginine Dimethylaminohydrolase 1, DDAHI, Dimethylargininase-1, DDAH)
125697 100 µg

DDAH1 (N (G), N (G) -dimethylarginine Dimethylaminohydrolase 1, DDAH-1, Dimethylarginine Dimethylaminohydrolase 1, DDAHI, Dimethylargininase-1, DDAH)

Sign In for Pricing
View Details