Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACTN1 Rabbit Polyclonal Antibody (HRP)

ACTN1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BDPLT15

UniProt

P12814

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ACTN1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LTRDAKGISQEQMNEFRASFNHFDRKKTGMMDTDDFRACLISMGYNMGEA

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

90kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001093.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRUB2 Rabbit Polyclonal Antibody
orb632193-01 50 µg

TRUB2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TRUB2 Rabbit Polyclonal Antibody
orb632193-02 100 µg

TRUB2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ZNF652 Antibody Blocking Peptide
orb1502062 500 µg

ZNF652 Antibody Blocking Peptide

Sign In for Pricing
View Details
Recombinant Shigella Dysenteriae ispG Protein (aa 1-372)
VAng-Lsx07440-1mgEcoli 1 mg (E. coli)

Recombinant Shigella Dysenteriae ispG Protein (aa 1-372)

Sign In for Pricing
View Details
Recombinant Desulfovibrio vulgaris subsp. vulgaris Probable inorganic polyphosphate/ATP-NAD kinase (ppnK)
MBS1051798-01 0.02 mg (E-Coli)

Recombinant Desulfovibrio vulgaris subsp. vulgaris Probable inorganic polyphosphate/ATP-NAD kinase (ppnK)

Sign In for Pricing
View Details
Recombinant Desulfovibrio vulgaris subsp. vulgaris Probable inorganic polyphosphate/ATP-NAD kinase (ppnK)
MBS1051798-02 0.02 mg (Yeast)

Recombinant Desulfovibrio vulgaris subsp. vulgaris Probable inorganic polyphosphate/ATP-NAD kinase (ppnK)

Sign In for Pricing
View Details