Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD40 Rabbit Polyclonal Antibody (FITC)

CD40 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

P50, Bp50, CDW40, TNFRSF5

UniProt

P25942

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CD40

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCD

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

20kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Guinea pig, Human, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_690593

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human DNAJB9 Protein, N-His
YHK50501 100 μg

Recombinant Human DNAJB9 Protein, N-His

Sign In for Pricing
View Details
CSN1S2B sgRNA CRISPR Lentivector set (Human)
K0516701 3x 1.0 µg

CSN1S2B sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
HRP-conjugated Monoclonal Mouse Anti-Chicken IgM, μ Chain Specific Secondary Antibody
AMS0501-01 200 µL

HRP-conjugated Monoclonal Mouse Anti-Chicken IgM, μ Chain Specific Secondary Antibody

Sign In for Pricing
View Details
HRP-conjugated Monoclonal Mouse Anti-Chicken IgM, μ Chain Specific Secondary Antibody
AMS0501-02 500 µL

HRP-conjugated Monoclonal Mouse Anti-Chicken IgM, μ Chain Specific Secondary Antibody

Sign In for Pricing
View Details
Anti-HAH1 Antibody
MBS8306079-01 0.03 mL

Anti-HAH1 Antibody

Sign In for Pricing
View Details
Anti-HAH1 Antibody
MBS8306079-02 0.05 mL

Anti-HAH1 Antibody

Sign In for Pricing
View Details