Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHGA Rabbit Polyclonal Antibody (FITC)

CHGA Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CGA

UniProt

P10645

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human CHGA

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: DSLEAGLPLQVRGYPEEKKEEEGSANRRPEDQELESLSAIEAELEKVAHQ

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001266

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

XBP1 Antibody (YA5104, Rabbit)
HY-P85412 1 Each

XBP1 Antibody (YA5104, Rabbit)

Sign In for Pricing
View Details
Human Golgi protein 73 (GP-73) ELISA Kit
MBS281486-01 48 Tests

Human Golgi protein 73 (GP-73) ELISA Kit

Sign In for Pricing
View Details
Human Golgi protein 73 (GP-73) ELISA Kit
MBS281486-02 96 Tests

Human Golgi protein 73 (GP-73) ELISA Kit

Sign In for Pricing
View Details
Human Golgi protein 73 (GP-73) ELISA Kit
MBS281486-03 5x 96 Tests

Human Golgi protein 73 (GP-73) ELISA Kit

Sign In for Pricing
View Details
Human Golgi protein 73 (GP-73) ELISA Kit
MBS281486-04 10x 96 Tests

Human Golgi protein 73 (GP-73) ELISA Kit

Sign In for Pricing
View Details
NR4A1 (S351) (Nuclear Receptor Subfamily 4 Group A Member 1, Orphan Nuclear Receptor TR3, Orphan Nuclear Receptor HMR, Early Response Protein NAK1, Testicular Receptor 3, ST-59, Nur77, GFRP1, HMR, NAK1) (PE) discontinued
N0018-01H-PE 200 µL

NR4A1 (S351) (Nuclear Receptor Subfamily 4 Group A Member 1, Orphan Nuclear Receptor TR3, Orphan Nuclear Receptor HMR, Early Response Protein NAK1, Testicular Receptor 3, ST-59, Nur77, GFRP1, HMR, NAK1) (PE) discontinued

Sign In for Pricing
View Details