Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DHODH Rabbit Polyclonal Antibody (HRP)

DHODH Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

URA1, POADS, DHOdehase

UniProt

Q02127

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human DHODH

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIG

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_001352

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse CAV3 siRNA
abx910388-01 15 nmol

Mouse CAV3 siRNA

Sign In for Pricing
View Details
Mouse CAV3 siRNA
abx910388-02 30 nmol

Mouse CAV3 siRNA

Sign In for Pricing
View Details
RAB3A (Ras-related Protein Rab-3A) (APC)
132203-APC 100 µL

RAB3A (Ras-related Protein Rab-3A) (APC)

Sign In for Pricing
View Details
Human UNC5B (Netrin Receptor UNC5B) Microsample ELISA Kit
orb2997273-01 48 Tests

Human UNC5B (Netrin Receptor UNC5B) Microsample ELISA Kit

Sign In for Pricing
View Details
Human UNC5B (Netrin Receptor UNC5B) Microsample ELISA Kit
orb2997273-02 96 Tests

Human UNC5B (Netrin Receptor UNC5B) Microsample ELISA Kit

Sign In for Pricing
View Details
PP1 beta (protein phosphatase 1, catalytic subunit, beta isoform, MGC3672, PP-1B, PPP1CD, Serine/threonine-protein Phosphatase PP1-beta catalytic subunit) (PE)
MBS6495399-01 0.1 mL

PP1 beta (protein phosphatase 1, catalytic subunit, beta isoform, MGC3672, PP-1B, PPP1CD, Serine/threonine-protein Phosphatase PP1-beta catalytic subunit) (PE)

Sign In for Pricing
View Details