Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DHODH Rabbit Polyclonal Antibody (HRP)

DHODH Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

URA1, POADS, DHOdehase

UniProt

Q02127

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human DHODH

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLR

Field of Research

Metabolism Research

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001352

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAP4K4 pSer629 Rabbit Polyclonal Antibody
AP12850PU-N 400 µL

MAP4K4 pSer629 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human ASAH3L (ACER2) activation kit by CRISPRa
GA117482 1 Kit

Human ASAH3L (ACER2) activation kit by CRISPRa

Sign In for Pricing
View Details
1-O-Acetyl 2,3,5-Tri-O-p-chlorobenzoyl-Beta-D-ribofuranoside
TRC-A189525-250MG 250 mg

1-O-Acetyl 2,3,5-Tri-O-p-chlorobenzoyl-Beta-D-ribofuranoside

Sign In for Pricing
View Details
Automatic Nucleic Acid Extraction System BNPS-203
BNPS-203 1 Unit

Automatic Nucleic Acid Extraction System BNPS-203

Sign In for Pricing
View Details
alpha 1 Antitrypsin (SERPINA1) (Center) Rabbit Polyclonal Antibody
AP53855PU-N 400 µL

alpha 1 Antitrypsin (SERPINA1) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon: sigmoid
CS647171 5x 5 µm

Frozen Tissue Sections, Colon: sigmoid

Sign In for Pricing
View Details