Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HGFAC Rabbit Polyclonal Antibody (Biotin)

HGFAC Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HGFA

UniProt

D6RAR4

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human HGFAC

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SSLREALVPLVADHKCSSPEVYGADISPNMLCAGYFDCKSDACQGDSGGP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

72kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_001284368.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CALNA2, NT (Calmodulin-dependent Calcineurin A Subunit, beta Isoform, Serine/Threonine Protein Phosphatase 2B Catalytic Subunit, beta Isoform, CAM-PRP Catalytic Subunit, PPP3CB, CNA2) (MaxLight 550) discontinued
C0114-11-ML550 100 µL

CALNA2, NT (Calmodulin-dependent Calcineurin A Subunit, beta Isoform, Serine/Threonine Protein Phosphatase 2B Catalytic Subunit, beta Isoform, CAM-PRP Catalytic Subunit, PPP3CB, CNA2) (MaxLight 550) discontinued

Sign In for Pricing
View Details
C8orf42 3'UTR Luciferase Stable Cell Line
TU002525 1.0 mL

C8orf42 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Chicken Defensinβ (DEFβ) ELISA Kit
YP-W69366-01 48 Tests

Chicken Defensinβ (DEFβ) ELISA Kit

Sign In for Pricing
View Details
Chicken Defensinβ (DEFβ) ELISA Kit
YP-W69366-02 96 Tests

Chicken Defensinβ (DEFβ) ELISA Kit

Sign In for Pricing
View Details
Canine Anti Myocardial Antibody IgG ELISA Kit
MBS7261408-01 48 Well

Canine Anti Myocardial Antibody IgG ELISA Kit

Sign In for Pricing
View Details
Canine Anti Myocardial Antibody IgG ELISA Kit
MBS7261408-02 96 Well

Canine Anti Myocardial Antibody IgG ELISA Kit

Sign In for Pricing
View Details