Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MPPED2 Rabbit Polyclonal Antibody (HRP)

MPPED2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

239FB, C11orf8

UniProt

Q15777

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human MPPED2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PKLHVFGGIHEGYGIMTDGYTTYINASTCTVSFQPTNPPIIFDLPNPQGS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001575

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRAF3IP3 Antibody
orb1287867 100 µL

TRAF3IP3 Antibody

Sign In for Pricing
View Details
CLDN2, NT (Claudin-2, SP82, PSEC0059, SP82, UNQ705/PRO1356) (MaxLight 550)
MBS6469281-01 0.1 mL

CLDN2, NT (Claudin-2, SP82, PSEC0059, SP82, UNQ705/PRO1356) (MaxLight 550)

Sign In for Pricing
View Details
CLDN2, NT (Claudin-2, SP82, PSEC0059, SP82, UNQ705/PRO1356) (MaxLight 550)
MBS6469281-02 5x 0.1 mL

CLDN2, NT (Claudin-2, SP82, PSEC0059, SP82, UNQ705/PRO1356) (MaxLight 550)

Sign In for Pricing
View Details
Phospho-PTEN (Thr 366) Rabbit mAb
C06310-100uL 100 µL

Phospho-PTEN (Thr 366) Rabbit mAb

Sign In for Pricing
View Details
Recombinant Treponema pallidum Chemotaxis protein CheY (cheY)
MBS1004053-01 0.02 mg (E-Coli)

Recombinant Treponema pallidum Chemotaxis protein CheY (cheY)

Sign In for Pricing
View Details
Recombinant Treponema pallidum Chemotaxis protein CheY (cheY)
MBS1004053-02 0.1 mg (E-Coli)

Recombinant Treponema pallidum Chemotaxis protein CheY (cheY)

Sign In for Pricing
View Details