Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dpt Rabbit Polyclonal Antibody (HRP)

Dpt Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Eq1, EQ-1, 1810032B19Rik, 5033416F05Rik

UniProt

Q9QZZ6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GFSYQCPHGQVVVAVRSIFSKKEGSDRQWNYACMPTPQSLGEPTECWWEE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_062733

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBFD1 Antibody - middle region
ARP68752_P050-25UL 25 µL

UBFD1 Antibody - middle region

Sign In for Pricing
View Details
G Protein-Coupled Receptor Class C Group 5 Member B (GPRC5B) Antibody
abx008138-01 30 µL

G Protein-Coupled Receptor Class C Group 5 Member B (GPRC5B) Antibody

Sign In for Pricing
View Details
G Protein-Coupled Receptor Class C Group 5 Member B (GPRC5B) Antibody
abx008138-02 100 µL

G Protein-Coupled Receptor Class C Group 5 Member B (GPRC5B) Antibody

Sign In for Pricing
View Details
G Protein-Coupled Receptor Class C Group 5 Member B (GPRC5B) Antibody
abx008138-03 200 µL

G Protein-Coupled Receptor Class C Group 5 Member B (GPRC5B) Antibody

Sign In for Pricing
View Details
(3β,5β,12α)-3,12-Dihydroxycholan-24-oic Acid
TRC-D251110-25MG 25 mg

(3β,5β,12α)-3,12-Dihydroxycholan-24-oic Acid

Sign In for Pricing
View Details
Mouse Monoclonal PRR7 Antibody (TRAP3/10) [mFluor Violet 450 SE]
NBP1-30424MFV450 0.1 mL

Mouse Monoclonal PRR7 Antibody (TRAP3/10) [mFluor Violet 450 SE]

Sign In for Pricing
View Details