Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIR2DL4 Rabbit Polyclonal Antibody (FITC)

KIR2DL4 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

G9P, CD158D, KIR103, KIR-2DL4, KIR103AS, KIR-103AS

UniProt

Q8NHK1

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human KIR2DL4

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VSVTGNPSSSWPSPTEPSFKTGIARHLHAVIRYSVAIILFTILPFFLLHR

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_001074241

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FABP2, NT (FABP2, FABPI, Fatty acid-binding protein, intestinal, Fatty acid-binding protein 2, Intestinal-type fatty acid-binding protein) (PE)
MBS6297580-01 0.2 mL

FABP2, NT (FABP2, FABPI, Fatty acid-binding protein, intestinal, Fatty acid-binding protein 2, Intestinal-type fatty acid-binding protein) (PE)

Sign In for Pricing
View Details
FABP2, NT (FABP2, FABPI, Fatty acid-binding protein, intestinal, Fatty acid-binding protein 2, Intestinal-type fatty acid-binding protein) (PE)
MBS6297580-02 5x 0.2 mL

FABP2, NT (FABP2, FABPI, Fatty acid-binding protein, intestinal, Fatty acid-binding protein 2, Intestinal-type fatty acid-binding protein) (PE)

Sign In for Pricing
View Details
ERAP1 Antibody
A13587-50UG 50 µg

ERAP1 Antibody

Sign In for Pricing
View Details
Nova1 Rabbit Polyclonal Antibody (BF750)
orb2545458 100 µL

Nova1 Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
Cgref1 (Cell Growth Regulator with EF hand Domain Protein 1, Cell Growth Regulatory gene 11 Protein, Hydrophobestin, Cgref1, Cgr11) (MaxLight 550)
MBS6455069-01 0.1 mL

Cgref1 (Cell Growth Regulator with EF hand Domain Protein 1, Cell Growth Regulatory gene 11 Protein, Hydrophobestin, Cgref1, Cgr11) (MaxLight 550)

Sign In for Pricing
View Details
Cgref1 (Cell Growth Regulator with EF hand Domain Protein 1, Cell Growth Regulatory gene 11 Protein, Hydrophobestin, Cgref1, Cgr11) (MaxLight 550)
MBS6455069-02 5x 0.1 mL

Cgref1 (Cell Growth Regulator with EF hand Domain Protein 1, Cell Growth Regulatory gene 11 Protein, Hydrophobestin, Cgref1, Cgr11) (MaxLight 550)

Sign In for Pricing
View Details