Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIR2DL4 Rabbit Polyclonal Antibody (FITC)

KIR2DL4 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

G9P, CD158D, KIR103, KIR-2DL4, KIR103AS, KIR-103AS

UniProt

Q8NHK1

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human KIR2DL4

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VSVTGNPSSSWPSPTEPSFKTGIARHLHAVIRYSVAIILFTILPFFLLHR

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_001074241

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Dual Specificity Protein Phosphatase 7 (DUSP7) ELISA Kit
abx511193 96 Tests

Rat Dual Specificity Protein Phosphatase 7 (DUSP7) ELISA Kit

Sign In for Pricing
View Details
KTI12 Protein Lysate (Rat) with C-HA Tag
26233036 100 µg

KTI12 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
SPDYE2 CRISPR Knock Out 293T Cell Line (Human)
45252141 1x 10^6 Cells / 1.0 mL

SPDYE2 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Zcchc3 ORF Vector (Mouse) (pORF)
50766014 1.0 µg DNA

Zcchc3 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Rabbit Anti ACO2 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Western Blot, Immunofluorescence)
MBS8422162-01 0.001 mL

Rabbit Anti ACO2 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Western Blot, Immunofluorescence)

Sign In for Pricing
View Details
Rabbit Anti ACO2 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Western Blot, Immunofluorescence)
MBS8422162-02 5x 0.001 mL

Rabbit Anti ACO2 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Western Blot, Immunofluorescence)

Sign In for Pricing
View Details