Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KRT13 Rabbit Polyclonal Antibody (FITC)

KRT13 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

K13, CK13, WSN2

UniProt

P13646

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human KRT13

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TMQNLNDRLASYLEKVRALEEANADLEVKIRDWHLKQSPASPERDYSPYY

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_002265

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAPK8 (Mitogen-Activated Protein Kinase 8, JNK, JNK1, JNK1A2, JNK21B1/2, PRKM8, SAPK1)
248512 100 µg

MAPK8 (Mitogen-Activated Protein Kinase 8, JNK, JNK1, JNK1A2, JNK21B1/2, PRKM8, SAPK1)

Sign In for Pricing
View Details
GINS2, ID (GINS2, PSF2, DNA replication complex GINS protein PSF2, GINS complex subunit 2) (MaxLight 490) discontinued
036043-ML490 100 µL

GINS2, ID (GINS2, PSF2, DNA replication complex GINS protein PSF2, GINS complex subunit 2) (MaxLight 490) discontinued

Sign In for Pricing
View Details
NK1.1 antibody (biotin)
61R-1625-01 0.05 mg

NK1.1 antibody (biotin)

Sign In for Pricing
View Details
NK1.1 antibody (biotin)
61R-1625-02 0.1 mg

NK1.1 antibody (biotin)

Sign In for Pricing
View Details
SPC24 Antibody, HRP conjugated
MBS7044658-01 0.05 mg

SPC24 Antibody, HRP conjugated

Sign In for Pricing
View Details
SPC24 Antibody, HRP conjugated
MBS7044658-02 0.1 mg

SPC24 Antibody, HRP conjugated

Sign In for Pricing
View Details