Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KRT13 Rabbit Polyclonal Antibody (HRP)

KRT13 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

K13, CK13, WSN2

UniProt

P13646

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human KRT13

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EAQLSELRSEMECQNQEYKMLLDIKTRLEQEIATYRSLLEGQDAKKRQPP

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_002265

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human RAB13 shRNA (UAS) - Lentiviral human RAB13 shRNA (UAS) (100)
GTR15323469 1 Vial

Lentiviral human RAB13 shRNA (UAS) - Lentiviral human RAB13 shRNA (UAS) (100)

Sign In for Pricing
View Details
Recombinant Arthrobacter aurescens Phosphoribosyl-ATP pyrophosphatase (hisE)
MBS1185419-01 0.02 mg (E-Coli)

Recombinant Arthrobacter aurescens Phosphoribosyl-ATP pyrophosphatase (hisE)

Sign In for Pricing
View Details
Recombinant Arthrobacter aurescens Phosphoribosyl-ATP pyrophosphatase (hisE)
MBS1185419-02 0.1 mg (E-Coli)

Recombinant Arthrobacter aurescens Phosphoribosyl-ATP pyrophosphatase (hisE)

Sign In for Pricing
View Details
Recombinant Arthrobacter aurescens Phosphoribosyl-ATP pyrophosphatase (hisE)
MBS1185419-03 0.02 mg (Yeast)

Recombinant Arthrobacter aurescens Phosphoribosyl-ATP pyrophosphatase (hisE)

Sign In for Pricing
View Details
Recombinant Arthrobacter aurescens Phosphoribosyl-ATP pyrophosphatase (hisE)
MBS1185419-04 0.1 mg (Yeast)

Recombinant Arthrobacter aurescens Phosphoribosyl-ATP pyrophosphatase (hisE)

Sign In for Pricing
View Details
Recombinant Arthrobacter aurescens Phosphoribosyl-ATP pyrophosphatase (hisE)
MBS1185419-05 0.02 mg (Baculovirus)

Recombinant Arthrobacter aurescens Phosphoribosyl-ATP pyrophosphatase (hisE)

Sign In for Pricing
View Details