Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MGMT Rabbit Polyclonal Antibody (FITC)

MGMT Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

P16455

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MGMT

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGG

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_002403

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C8orf58 Human Over-expression Lysate
orb1339018 100 µg

C8orf58 Human Over-expression Lysate

Sign In for Pricing
View Details
DCX (S128) (Neuronal Migration Protein Doublecortin, Lissencephalin-X, Lis-X, Doublin, DBCN, LISX) (PE) discontinued
D9080-01A-PE 200 µL

DCX (S128) (Neuronal Migration Protein Doublecortin, Lissencephalin-X, Lis-X, Doublin, DBCN, LISX) (PE) discontinued

Sign In for Pricing
View Details
FUS/TLS polyclonal antibody
BS90542 50ul

FUS/TLS polyclonal antibody

Sign In for Pricing
View Details
Acetyl-Histone H2A.X Antibody / Lysine 9 / H2AXK9ac
R20461-100UG 100 µg

Acetyl-Histone H2A.X Antibody / Lysine 9 / H2AXK9ac

Sign In for Pricing
View Details
LBX2, ID (LBX2, Transcription factor LBX2, Ladybird homeobox protein homolog 2) (MaxLight 550) discontinued
037697-ML550 100 µL

LBX2, ID (LBX2, Transcription factor LBX2, Ladybird homeobox protein homolog 2) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Anti-DACH2 Antibody Picoband® Biotin Conjugated
A11176-1-Biotin 100 µg/Vial

Anti-DACH2 Antibody Picoband® Biotin Conjugated

Sign In for Pricing
View Details