Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MGMT Rabbit Polyclonal Antibody (HRP)

MGMT Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

P16455

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MGMT

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGG

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_002403

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal Antibody to Hedgehog Homolog, Indian (IHH)
TRV-0057546-01 20 µL

Polyclonal Antibody to Hedgehog Homolog, Indian (IHH)

Sign In for Pricing
View Details
Polyclonal Antibody to Hedgehog Homolog, Indian (IHH)
TRV-0057546-02 100 µL

Polyclonal Antibody to Hedgehog Homolog, Indian (IHH)

Sign In for Pricing
View Details
Polyclonal Antibody to Hedgehog Homolog, Indian (IHH)
TRV-0057546-03 200 µL

Polyclonal Antibody to Hedgehog Homolog, Indian (IHH)

Sign In for Pricing
View Details
Polyclonal Antibody to Hedgehog Homolog, Indian (IHH)
TRV-0057546-04 1 mL

Polyclonal Antibody to Hedgehog Homolog, Indian (IHH)

Sign In for Pricing
View Details
RND2 (Rho-related GTP-binding Protein RhoN, RhoN, ARHN, Rho Family GTPase 2, Rho-related GTP-binding Protein Rho7, RHO7) (Biotin)
132624-Biotin 100 µL

RND2 (Rho-related GTP-binding Protein RhoN, RhoN, ARHN, Rho Family GTPase 2, Rho-related GTP-binding Protein Rho7, RHO7) (Biotin)

Sign In for Pricing
View Details
SIGLEC7 siRNA (Human)
CRH8934-01 15 nmol

SIGLEC7 siRNA (Human)

Sign In for Pricing
View Details