Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSG5 Rabbit Polyclonal Antibody (HRP)

PSG5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PSG, FL-NCA-3

UniProt

Q15238

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PSG5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SIPQITTKHRGLYTCSVRNSATGKESSKSMTVEVSAPSGIGRLPLLNPI

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_002772

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Neuronal Pentraxin 1 (NPTX1) ELISA Kit
orb1948347-01 48 Tests

Human Neuronal Pentraxin 1 (NPTX1) ELISA Kit

Sign In for Pricing
View Details
Human Neuronal Pentraxin 1 (NPTX1) ELISA Kit
orb1948347-02 96 Tests

Human Neuronal Pentraxin 1 (NPTX1) ELISA Kit

Sign In for Pricing
View Details
GREM2 (Gremlin-2, Cysteine Knot Superfamily 1, BMP Antagonist 2, DAN Domain Family Member 3, Protein Related to DAN and Cerberus, CKTSF1B2, DAND3, PRDC, FLJ21195) (MaxLight 550)
MBS6211766-01 0.1 mL

GREM2 (Gremlin-2, Cysteine Knot Superfamily 1, BMP Antagonist 2, DAN Domain Family Member 3, Protein Related to DAN and Cerberus, CKTSF1B2, DAND3, PRDC, FLJ21195) (MaxLight 550)

Sign In for Pricing
View Details
GREM2 (Gremlin-2, Cysteine Knot Superfamily 1, BMP Antagonist 2, DAN Domain Family Member 3, Protein Related to DAN and Cerberus, CKTSF1B2, DAND3, PRDC, FLJ21195) (MaxLight 550)
MBS6211766-02 5x 0.1 mL

GREM2 (Gremlin-2, Cysteine Knot Superfamily 1, BMP Antagonist 2, DAN Domain Family Member 3, Protein Related to DAN and Cerberus, CKTSF1B2, DAND3, PRDC, FLJ21195) (MaxLight 550)

Sign In for Pricing
View Details
HP 228
MBS5775232 Inquire

HP 228

Sign In for Pricing
View Details
Grin2b Antibody
MBS7130533-01 0.1 mL

Grin2b Antibody

Sign In for Pricing
View Details