Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rasa1 Rabbit Polyclonal Antibody (HRP)

Rasa1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

G, Gap, Rasa, p120-, RasGAP

UniProt

Q91YX7

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SNKHRMIMFLDELGNVPELPDTTEHSRTDLSRDLAALHEICVAHSDELRT

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

94kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_663427

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RFXANK (Center) Rabbit Polyclonal Antibody
AP53645PU-N 400 µL

RFXANK (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Parathyroid Hormone (PTH) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1C6]
TA800944AM 100 µL

Parathyroid Hormone (PTH) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1C6]

Sign In for Pricing
View Details
ZNF2 Human qPCR Primer Pair (NM_021088)
HP226552 200 Reactions

ZNF2 Human qPCR Primer Pair (NM_021088)

Sign In for Pricing
View Details
galectin 9 (LGALS9) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8B11]
TA805615BM 100 µL

galectin 9 (LGALS9) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8B11]

Sign In for Pricing
View Details
HLA-Pan (MHC II) (HLA-Pan/2967R), CF568 conjugate, 0.1mg/mL
BNC682967-100 1x 100 µL

HLA-Pan (MHC II) (HLA-Pan/2967R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21WAF1 (Tumor Suppressor Protein) (CIP1/2489R), CF405S conjugate, 0.1mg/mL
BNC042489-100 1x 100 µL

P21WAF1 (Tumor Suppressor Protein) (CIP1/2489R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details