Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A3 Rabbit Polyclonal Antibody (HRP)

S100A3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

S100E

UniProt

P33764

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human S100A3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEF

Field of Research

Signal Transduction

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

11kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_002951

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human DDX58 sgRNA gene knockout kit - Lentiviral human DDX58 sgRNA gene knockout kit (25)
GTR15399849 1 Vial

Lentiviral human DDX58 sgRNA gene knockout kit - Lentiviral human DDX58 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
MUC12 Rabbit Polyclonal Antibody (Biotin)
orb2117947 100 µL

MUC12 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Monkey IgA (alpha chain) Antibody Rhodamine Conjugated
orb1463547 1 mg

Monkey IgA (alpha chain) Antibody Rhodamine Conjugated

Sign In for Pricing
View Details
1700030F18Rik sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4619307 1.0 µg DNA

1700030F18Rik sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
GDF9 Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb1578374 100 µL

GDF9 Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
USF2 (NM_003367) Human Over-expression Lysate
LH06655V 100 µg

USF2 (NM_003367) Human Over-expression Lysate

Sign In for Pricing
View Details