Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SEMG1 Rabbit Polyclonal Antibody (HRP)

SEMG1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SGI, SEMG, CT103, dJ172H20.2

UniProt

P04279

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SEMG1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KDIFSTQDELLVYNKNQHQTKNLNQDQQHGRKANKISYQSSSTEERRLHY

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_937782

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAX5 / BSAP (Early B-Cell Marker) (rPAX5/2060), CF568 conjugate, 0.1mg/mL
BNC682301-500 1x 500 µL

PAX5 / BSAP (Early B-Cell Marker) (rPAX5/2060), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Calcineurin B / PPP3R1 (CALNB/2342), CF568 conjugate, 0.1mg/mL
BNC682342-500 1x 500 µL

Calcineurin B / PPP3R1 (CALNB/2342), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Apoptosis Signal Regulating Kinase 1 (ASK1) ELISA Kit
RD-ASK1-Hu-01 96 Tests

Human Apoptosis Signal Regulating Kinase 1 (ASK1) ELISA Kit

Sign In for Pricing
View Details
Human Apoptosis Signal Regulating Kinase 1 (ASK1) ELISA Kit
RD-ASK1-Hu-02 48 Tests

Human Apoptosis Signal Regulating Kinase 1 (ASK1) ELISA Kit

Sign In for Pricing
View Details
Human TADA3L (TADA3) activation kit by CRISPRa
GA107149 1 Kit

Human TADA3L (TADA3) activation kit by CRISPRa

Sign In for Pricing
View Details
CBFA2T3 (NM_005187) Human Recombinant Protein
TP312257L 1 mg

CBFA2T3 (NM_005187) Human Recombinant Protein

Sign In for Pricing
View Details