Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SEMG1 Rabbit Polyclonal Antibody (FITC)

SEMG1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

SGI, SEMG, CT103, dJ172H20.2

UniProt

P04279

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human SEMG1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GENGVQKDVSQSSIYSQTEEKAQGKSQKQITIPSQEQEHSQKANKISYQS

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_002998

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nt5c1b Mouse qPCR Primer Pair (NM_027588)
MP200087 200 Reactions

Nt5c1b Mouse qPCR Primer Pair (NM_027588)

Sign In for Pricing
View Details
Recombinant Mouse Pvr Protein, Fc/His-tagged, Alexa Fluor 488 conjugated
Pvr-623MAF488 20 μg- 50 μg- 100 μg

Recombinant Mouse Pvr Protein, Fc/His-tagged, Alexa Fluor 488 conjugated

Sign In for Pricing
View Details
ISY1 Antibody - C-terminal region : Biotin (ARP57838_P050-Biotin)
ARP57838_P050-Biotin 100 µL

ISY1 Antibody - C-terminal region : Biotin (ARP57838_P050-Biotin)

Sign In for Pricing
View Details
MARCH6 Polyclonal Antibody, PerCP Conjugated
bs-9340R-PerCP 100 µL

MARCH6 Polyclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details
PGK1 antibody - C-terminal region
MBS3208874-01 0.1 mL

PGK1 antibody - C-terminal region

Sign In for Pricing
View Details
PGK1 antibody - C-terminal region
MBS3208874-02 5x 0.1 mL

PGK1 antibody - C-terminal region

Sign In for Pricing
View Details