Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SEMG1 Rabbit Polyclonal Antibody (HRP)

SEMG1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SGI, SEMG, CT103, dJ172H20.2

UniProt

P04279

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human SEMG1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GENGVQKDVSQSSIYSQTEEKAQGKSQKQITIPSQEQEHSQKANKISYQS

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_002998

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Purified Anti-Human CD21 Antibody[HB5]
E-AB-F13770P-01 25 µg

Purified Anti-Human CD21 Antibody[HB5]

Sign In for Pricing
View Details
Purified Anti-Human CD21 Antibody[HB5]
E-AB-F13770P-02 100 µg

Purified Anti-Human CD21 Antibody[HB5]

Sign In for Pricing
View Details
Mouse 9030625G05Rik activation kit by CRISPRa
GA208854 1 Kit

Mouse 9030625G05Rik activation kit by CRISPRa

Sign In for Pricing
View Details
PBP (PEBP1) Rabbit Monoclonal Antibody
TA422587 100 µL

PBP (PEBP1) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Benzyl Benzoate
TRC-B230950-50G 50 g

Benzyl Benzoate

Sign In for Pricing
View Details
ARSF Polyclonal Antibody
E-AB-67946-01 60 µL

ARSF Polyclonal Antibody

Sign In for Pricing
View Details