Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STATH Rabbit Polyclonal Antibody (FITC)

STATH Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

STR

UniProt

P02808

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human STATH

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MKFLVFAFILALMVSMIGADSSEEKFLRRIGRFGYGYGPYQPVPEQPLYP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

7kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Yeast

Tested Applications

WB

NCBI Accession Number

NP_003145

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-MRE11/MRE11 Antibody Picoband® Fluoro550 Conjugated
A00731-2-Fluoro550 100 µg/Vial

Anti-MRE11/MRE11 Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details
TRSPAP1 (TRNAU1AP) (NM_017846) Human Over-expression Lysate
E45H17890-2 20 µg

TRSPAP1 (TRNAU1AP) (NM_017846) Human Over-expression Lysate

Sign In for Pricing
View Details
ALPPL2 (Alkaline Phosphatase, Placental-like, ALP-1, Alkaline Phosphatase Nagao Isozyme, Germ Cell Alkaline Phosphatase, GCAP, Placental Alkaline Phosphatase-like, PLAP-like, ALPPL) (AP)
MBS6369682-01 0.1 mL

ALPPL2 (Alkaline Phosphatase, Placental-like, ALP-1, Alkaline Phosphatase Nagao Isozyme, Germ Cell Alkaline Phosphatase, GCAP, Placental Alkaline Phosphatase-like, PLAP-like, ALPPL) (AP)

Sign In for Pricing
View Details
ALPPL2 (Alkaline Phosphatase, Placental-like, ALP-1, Alkaline Phosphatase Nagao Isozyme, Germ Cell Alkaline Phosphatase, GCAP, Placental Alkaline Phosphatase-like, PLAP-like, ALPPL) (AP)
MBS6369682-02 5x 0.1 mL

ALPPL2 (Alkaline Phosphatase, Placental-like, ALP-1, Alkaline Phosphatase Nagao Isozyme, Germ Cell Alkaline Phosphatase, GCAP, Placental Alkaline Phosphatase-like, PLAP-like, ALPPL) (AP)

Sign In for Pricing
View Details
DR5/TNFRSF10B Rabbit Polyclonal Antibody (Fluoro488)
orb3118540 100 µg

DR5/TNFRSF10B Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details
Mouse Monoclonal Glut2 Antibody (199017) [DyLight 594]
FAB1414M 0.2 mL

Mouse Monoclonal Glut2 Antibody (199017) [DyLight 594]

Sign In for Pricing
View Details