Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Timp2 Rabbit Polyclonal Antibody (FITC)

Timp2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

TIMP, Timp-2, D11Bwg1104e

UniProt

Q8BSJ3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ECLWMDWVTEKSINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_035724

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

hsa-miR-4650-5p miRNA Mimic
MBS8299494-01 5 nmol

hsa-miR-4650-5p miRNA Mimic

Sign In for Pricing
View Details
hsa-miR-4650-5p miRNA Mimic
MBS8299494-02 10 nmol

hsa-miR-4650-5p miRNA Mimic

Sign In for Pricing
View Details
hsa-miR-4650-5p miRNA Mimic
MBS8299494-03 5x 10 nmol

hsa-miR-4650-5p miRNA Mimic

Sign In for Pricing
View Details
Lentiviral mouse Zfyve27 shRNA (UAS) - Lentiviral mouse Zfyve27 shRNA (UAS, GFP) (100)
GTR15294492 1 Vial

Lentiviral mouse Zfyve27 shRNA (UAS) - Lentiviral mouse Zfyve27 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Lentiviral mouse Adipor1 shRNA (UAS) - Lentiviral mouse Adipor1 shRNA (UAS, GFP) (100)
GTR15233121 1 Vial

Lentiviral mouse Adipor1 shRNA (UAS) - Lentiviral mouse Adipor1 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Tsta3 3'UTR GFP Stable Cell Line
TU171274 1.0 mL

Tsta3 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details