Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Timp2 Rabbit Polyclonal Antibody (FITC)

Timp2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

TIMP, Timp-2, D11Bwg1104e

UniProt

Q8BSJ3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ECLWMDWVTEKSINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_035724

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PHKG1 Antibody
CSB-PA046995 100 µL

PHKG1 Antibody

Sign In for Pricing
View Details
10ml Serological Pipette, PS, Individual Packing, sterile, one piece construction
SPTS10 50 PCS/Bag - 10 Bags/Case

10ml Serological Pipette, PS, Individual Packing, sterile, one piece construction

Sign In for Pricing
View Details
Mouse Pituitary Adenylate Cyclase Activating Peptide (PACAP) ELISA Kit
orb2809751-01 48 Tests

Mouse Pituitary Adenylate Cyclase Activating Peptide (PACAP) ELISA Kit

Sign In for Pricing
View Details
Mouse Pituitary Adenylate Cyclase Activating Peptide (PACAP) ELISA Kit
orb2809751-02 96 Tests

Mouse Pituitary Adenylate Cyclase Activating Peptide (PACAP) ELISA Kit

Sign In for Pricing
View Details
Mouse Pituitary Adenylate Cyclase Activating Peptide (PACAP) ELISA Kit
orb2809751-03 5 x 96 T

Mouse Pituitary Adenylate Cyclase Activating Peptide (PACAP) ELISA Kit

Sign In for Pricing
View Details
PICALM Antibody (Center)
MBS9216698-01 0.08 mL

PICALM Antibody (Center)

Sign In for Pricing
View Details