Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPFIBP1 Rabbit Polyclonal Antibody (Biotin)

PPFIBP1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

L2, SGT2, hSGT2, hSgt2p

UniProt

Q86W92

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PPFIBP1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PFMGSLRALHLVEDLRGLLEMMETDEKEGLRCQIPDSTAETLVEWLQSQM

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

19kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_803193

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UCHL1/PGP9.5, Recombinant, Human, His-Tag, Active discontinued
046600 50 µg

UCHL1/PGP9.5, Recombinant, Human, His-Tag, Active discontinued

Sign In for Pricing
View Details
PLAUR antibody
70R-19332 50 μL

PLAUR antibody

Sign In for Pricing
View Details
Human 630K Genotyping Panel
PH2007042-01 96 Reactions

Human 630K Genotyping Panel

Sign In for Pricing
View Details
Human 630K Genotyping Panel
PH2007042-02 96 Reactions

Human 630K Genotyping Panel

Sign In for Pricing
View Details
Phospho-Tau (Ser396) Antibody (YA7474, Rabbit)
HY-P87789 1 Each

Phospho-Tau (Ser396) Antibody (YA7474, Rabbit)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Reticulon-like protein B11 (RTNLB11)
MBS7029170-01 0.02 mg

Recombinant Arabidopsis thaliana Reticulon-like protein B11 (RTNLB11)

Sign In for Pricing
View Details