Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPFIBP1 Rabbit Polyclonal Antibody (HRP)

PPFIBP1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

L2, SGT2, hSGT2, hSgt2p

UniProt

Q86W92

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PPFIBP1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PFMGSLRALHLVEDLRGLLEMMETDEKEGLRCQIPDSTAETLVEWLQSQM

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

19kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_803193

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNU7-50P CRISPRa sgRNA lentivector (set of three targets)(Human)
40562121 3x 1.0µg DNA

RNU7-50P CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Hemoglobin/HBA1/HBA2 Rabbit Polyclonal Antibody (Fluoro488)
orb3119427 100 µg

Hemoglobin/HBA1/HBA2 Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details
Mouse Monoclonal HMBS Antibody (OTI3F4) [DyLight 488]
NBP2-70894G 0.1 mL

Mouse Monoclonal HMBS Antibody (OTI3F4) [DyLight 488]

Sign In for Pricing
View Details
Human Programmed Death 1 ELISA Kit
MBS7254421-01 48 Well

Human Programmed Death 1 ELISA Kit

Sign In for Pricing
View Details
Human Programmed Death 1 ELISA Kit
MBS7254421-02 96 Well

Human Programmed Death 1 ELISA Kit

Sign In for Pricing
View Details
Human Programmed Death 1 ELISA Kit
MBS7254421-03 5x 96 Well

Human Programmed Death 1 ELISA Kit

Sign In for Pricing
View Details