Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPFIBP1 Rabbit Polyclonal Antibody (Biotin)

PPFIBP1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

L2, SGT2, hSGT2, hSgt2p

UniProt

Q86W92

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence QSQMTNGHLPGNGDVYQERLARLENDKESLVLQVSVLTDQVEAQGEKIRD

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QSQMTNGHLPGNGDVYQERLARLENDKESLVLQVSVLTDQVEAQGEKIRD

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

114 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

NCBI Accession Number

NP_003613

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Galectin 1/LGALS1 Antibody Picoband®, PE Conjugate
PA1422-PE 100 µg/Vial

Anti-Galectin 1/LGALS1 Antibody Picoband®, PE Conjugate

Sign In for Pricing
View Details
Porcine GDF9 ELISA Kit (Ready to Use)
orb554360-01 48 Tests

Porcine GDF9 ELISA Kit (Ready to Use)

Sign In for Pricing
View Details
Porcine GDF9 ELISA Kit (Ready to Use)
orb554360-02 96 Tests

Porcine GDF9 ELISA Kit (Ready to Use)

Sign In for Pricing
View Details
Rabbit anti-INF2 Antibody, Affinity Purified
MBS3903700-01 0.002 mg

Rabbit anti-INF2 Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-INF2 Antibody, Affinity Purified
MBS3903700-02 0.02 mg

Rabbit anti-INF2 Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-INF2 Antibody, Affinity Purified
MBS3903700-03 5x 0.002 mg

Rabbit anti-INF2 Antibody, Affinity Purified

Sign In for Pricing
View Details