Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPFIBP1 Rabbit Polyclonal Antibody (HRP)

PPFIBP1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

L2, SGT2, hSGT2, hSgt2p

UniProt

Q86W92

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence QSQMTNGHLPGNGDVYQERLARLENDKESLVLQVSVLTDQVEAQGEKIRD

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QSQMTNGHLPGNGDVYQERLARLENDKESLVLQVSVLTDQVEAQGEKIRD

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

114 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

NCBI Accession Number

NP_003613

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Protein A Pure
P-01-5 5 mg

Protein A Pure

Sign In for Pricing
View Details
Recombinant EGLN3 Antibody
RC-4545-01 50 μL

Recombinant EGLN3 Antibody

Sign In for Pricing
View Details
Recombinant EGLN3 Antibody
RC-4545-02 100 µL

Recombinant EGLN3 Antibody

Sign In for Pricing
View Details
Recombinant EGLN3 Antibody
RC-4545-03 1 mL

Recombinant EGLN3 Antibody

Sign In for Pricing
View Details
α, ω-Bis-Succinamic Acid NHS Ester PEG
1120000-35.1G 1 g

α, ω-Bis-Succinamic Acid NHS Ester PEG

Sign In for Pricing
View Details
Cre Goat Polyclonal Antibody
AB0124-500 1.5 mg

Cre Goat Polyclonal Antibody

Sign In for Pricing
View Details