Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLPP1 Rabbit Polyclonal Antibody (Biotin)

PLPP1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

LPP1, PAP2, LLP1a, PAP-2a, PPAP2A

UniProt

O14494

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PPAP2A

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QRGVFCNDESIKYPYKEDTIPYALLGGIIIPFSIIVIILGETLSVYCNLL

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_003702

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OCT3 Antibody
E18-5358-1 50 µg - 50 µL

OCT3 Antibody

Sign In for Pricing
View Details
Human Prostaglandin I2 Synthase MAb (Clone 852307)
MAB7788 100 µg

Human Prostaglandin I2 Synthase MAb (Clone 852307)

Sign In for Pricing
View Details
MAP1LC3A, cleaved (LC3B, Microtubule-associated proteins 1A/1B light chain 3A, Autophagy-related protein LC3 A, Autophagy-related ubiquitin-like modifier LC3 A, MAP1 light chain 3-like protein 1, MAP1A/MAP1B light chain 3 A, Microtubule-associated protein
MBS6318330-01 0.2 mL

MAP1LC3A, cleaved (LC3B, Microtubule-associated proteins 1A/1B light chain 3A, Autophagy-related protein LC3 A, Autophagy-related ubiquitin-like modifier LC3 A, MAP1 light chain 3-like protein 1, MAP1A/MAP1B light chain 3 A, Microtubule-associated protein

Sign In for Pricing
View Details
MAP1LC3A, cleaved (LC3B, Microtubule-associated proteins 1A/1B light chain 3A, Autophagy-related protein LC3 A, Autophagy-related ubiquitin-like modifier LC3 A, MAP1 light chain 3-like protein 1, MAP1A/MAP1B light chain 3 A, Microtubule-associated protein
MBS6318330-02 5x 0.2 mL

MAP1LC3A, cleaved (LC3B, Microtubule-associated proteins 1A/1B light chain 3A, Autophagy-related protein LC3 A, Autophagy-related ubiquitin-like modifier LC3 A, MAP1 light chain 3-like protein 1, MAP1A/MAP1B light chain 3 A, Microtubule-associated protein

Sign In for Pricing
View Details
Recombinant Carassius auratus Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform (ppp2r2b)
MBS1027831-01 0.02 mg (E-Coli)

Recombinant Carassius auratus Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform (ppp2r2b)

Sign In for Pricing
View Details
Recombinant Carassius auratus Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform (ppp2r2b)
MBS1027831-02 0.02 mg (Yeast)

Recombinant Carassius auratus Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform (ppp2r2b)

Sign In for Pricing
View Details