Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MTMR1 Rabbit Polyclonal Antibody (FITC)

MTMR1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q13613

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human MTMR1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KEDVYTKTISLWSYINSQLDEFSNPFFVNYENHVLYPVASLSHLELWVNY

Field of Research

Signal Transduction

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

73kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_003819

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Pancreas
CR562322 5 µg

Tissue Total RNA, Pancreas

Sign In for Pricing
View Details
Human Progestin Receptor Beta (PAQR8) activation kit by CRISPRa
GA113848 1 Kit

Human Progestin Receptor Beta (PAQR8) activation kit by CRISPRa

Sign In for Pricing
View Details
SH3KBP1 (NM_001024666) Human Recombinant Protein
TP315701M 100 µg

SH3KBP1 (NM_001024666) Human Recombinant Protein

Sign In for Pricing
View Details
3,3'-((2-Hydroxypropane-1,3-diyl)bis(oxy))bis(4-chlorobenzoic acid) Diethyl Ester
TRC-H952720-50MG 50 mg

3,3'-((2-Hydroxypropane-1,3-diyl)bis(oxy))bis(4-chlorobenzoic acid) Diethyl Ester

Sign In for Pricing
View Details
Rgs5 Mouse Gene Knockout Kit (CRISPR)
KN514741 1 Kit

Rgs5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Seladin 1 (DHCR24) (NM_014762) Human Over-expression Lysate
LC402373 20 µg

Seladin 1 (DHCR24) (NM_014762) Human Over-expression Lysate

Sign In for Pricing
View Details