Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Alpha-2-HS-glycoprotein (AHSG), partial (Active)

Product Specifications

Product Name Alternative

Alpha-2-HS-Glycoprotein; Alpha-2-Z-Globulin; Ba-Alpha-2-Glycoprotein; Fetuin-A; AHSG; FETUA

Abbreviation

Recombinant Human Fetuin A protein, partial (Active)

Gene Name

Fetuin A

UniProt

P02765

Expression Region

19-300aa&341-367aa

Organism

Homo sapiens (Human)

Target Sequence

TVVQPSVGAAAGPVVPPCPGRIRHFKV&APHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKVWPQQPSGELFEIEIDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSAEDVRKVCQDCPLLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTDCVAKEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCMVFQTQPVSSQPQPEGANEAVPTPVVDPDAPPSPPLGAPGLPPAGSPPDSHVL

Tag

Tag free

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Others

Endotoxin

≤0.5EU/mg by the LAL method

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Measured in a cell proliferation assay using B16-F1 cells. Human Fetuin A stimulates adhesion of B16-F1 cells. The ED50 for this effect is 50-200 μg/mL. Optimal concentration depends on cell type as well as the application or research objectives.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered solution containing 10 mM PB, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

32.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTGER3 Antibody
OACD03247-1ML 1 mL

PTGER3 Antibody

Sign In for Pricing
View Details
LECT2, NT (Leukocyte Cell-derived Chemotaxin-2, LECT-2, hLECT2, chm2, chm-II, MGC126628) (Azide free) (HRP)
MBS6484738-01 0.2 mL

LECT2, NT (Leukocyte Cell-derived Chemotaxin-2, LECT-2, hLECT2, chm2, chm-II, MGC126628) (Azide free) (HRP)

Sign In for Pricing
View Details
LECT2, NT (Leukocyte Cell-derived Chemotaxin-2, LECT-2, hLECT2, chm2, chm-II, MGC126628) (Azide free) (HRP)
MBS6484738-02 5x 0.2 mL

LECT2, NT (Leukocyte Cell-derived Chemotaxin-2, LECT-2, hLECT2, chm2, chm-II, MGC126628) (Azide free) (HRP)

Sign In for Pricing
View Details
Phospho-EGFR (Thr678) ELISA Kit
EKA50971 192 Tests

Phospho-EGFR (Thr678) ELISA Kit

Sign In for Pricing
View Details
6- (4-Aminophenyl) -1,3-diazinane-2,4-dione
QDA84043-01 50 mg

6- (4-Aminophenyl) -1,3-diazinane-2,4-dione

Sign In for Pricing
View Details
6- (4-Aminophenyl) -1,3-diazinane-2,4-dione
QDA84043-02 0.5 g

6- (4-Aminophenyl) -1,3-diazinane-2,4-dione

Sign In for Pricing
View Details