Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Btrc Rabbit Polyclonal Antibody (Biotin)

Btrc Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Beta-TrCP1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PSLRCLYNPGTGALTAFQNSSEREDCNNGEPPRKIIPEKNSLRQTYNSCA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

68kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001007149

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IGHVIII-47-1 ORF Vector (Human) (pORF)
ORF021619 1.0 µg DNA

IGHVIII-47-1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Mouse Olfactory receptor 1N1 (OR1N1) ELISA Kit
MBS7215921-01 48 Well

Mouse Olfactory receptor 1N1 (OR1N1) ELISA Kit

Sign In for Pricing
View Details
Mouse Olfactory receptor 1N1 (OR1N1) ELISA Kit
MBS7215921-02 96 Well

Mouse Olfactory receptor 1N1 (OR1N1) ELISA Kit

Sign In for Pricing
View Details
Mouse Olfactory receptor 1N1 (OR1N1) ELISA Kit
MBS7215921-03 5x 96 Well

Mouse Olfactory receptor 1N1 (OR1N1) ELISA Kit

Sign In for Pricing
View Details
Mouse Olfactory receptor 1N1 (OR1N1) ELISA Kit
MBS7215921-04 10x 96 Well

Mouse Olfactory receptor 1N1 (OR1N1) ELISA Kit

Sign In for Pricing
View Details
B7-H4 Rabbit mAb
F3059-20uL 20 µL

B7-H4 Rabbit mAb

Sign In for Pricing
View Details