Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PGD2 Synthase/PTGDS, Rat (HEK293, His)

The PGD2 synthase/PTGDS protein converts PGH2 to PGD2, which regulates smooth muscle and inhibits platelet aggregation.It affects central nervous system functions including sedation, NREM sleep, and potential anti-apoptotic effects on oligodendrocytes.PGD2 Synthase/PTGDS Protein, Rat (HEK293, His) is the recombinant rat-derived PGD2 Synthase/PTGDS protein, expressed by HEK293 , with C-His, C-6*His labeled tag.

Product Specifications

Product Name Alternative

PGD2 Synthase/PTGDS Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pgd2-synthase-ptgds-protein-rat-hek293-his.html

Purity

96.00

Smiles

QGHDTVQPNFQQDKFLGRWYSAGLASNSSWFREKKELLFMCQTVVAPSTEGGLNLTSTFLRKNQCETKVMVLQPAGVPGQYTYNSPHWGSFHSLSVVETDYDEYAFLFSKGTKGPGQDFRMATLYSRAQLLKEELKEKFITFSKDQGLTEEDIVFLPQPDKCIQE

Molecular Formula

25526 (Gene_ID) P22057/NP_037147.1 (Q25-E189) (Accession)

Molecular Weight

Approximately 26-29 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P21 / WAF1 (WA-1), CF740 conjugate, 0.1mg/mL
BNC740043-100 1x 100 µL

P21 / WAF1 (WA-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF488A conjugate, 0.1mg/mL
BNC880257-500 1x 500 µL

Cytokeratin, HMW (AE-3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF647 conjugate, 0.1mg/mL
BNC471035-500 1x 500 µL

CD8 (C8/1035), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Neurofilament (NF-L) (NFL/736), CF405S conjugate, 0.1mg/mL
BNC040736-500 1x 500 µL

Neurofilament (NF-L) (NFL/736), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TTF-1 / NKX2.1 (Thyroid & Lung Epithelial Marker) (rNX2.1/690), CF488A conjugate, 0.1mg/mL
BNC881853-500 1x 500 µL

TTF-1 / NKX2.1 (Thyroid & Lung Epithelial Marker) (rNX2.1/690), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (T-Cell Marker) (SPN/2049R), CF488A conjugate, 0.1mg/mL
BNC882049-100 1x 100 µL

CD43 (T-Cell Marker) (SPN/2049R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details