Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PGD2 Synthase/PTGDS, Rat (HEK293, His)

The PGD2 synthase/PTGDS protein converts PGH2 to PGD2, which regulates smooth muscle and inhibits platelet aggregation.It affects central nervous system functions including sedation, NREM sleep, and potential anti-apoptotic effects on oligodendrocytes.PGD2 Synthase/PTGDS Protein, Rat (HEK293, His) is the recombinant rat-derived PGD2 Synthase/PTGDS protein, expressed by HEK293 , with C-His, C-6*His labeled tag.

Product Specifications

Product Name Alternative

PGD2 Synthase/PTGDS Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pgd2-synthase-ptgds-protein-rat-hek293-his.html

Purity

96.00

Smiles

QGHDTVQPNFQQDKFLGRWYSAGLASNSSWFREKKELLFMCQTVVAPSTEGGLNLTSTFLRKNQCETKVMVLQPAGVPGQYTYNSPHWGSFHSLSVVETDYDEYAFLFSKGTKGPGQDFRMATLYSRAQLLKEELKEKFITFSKDQGLTEEDIVFLPQPDKCIQE

Molecular Formula

25526 (Gene_ID) P22057/NP_037147.1 (Q25-E189) (Accession)

Molecular Weight

Approximately 26-29 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTRP3 Antibody
MBS9612391-01 0.1 mL

CTRP3 Antibody

Sign In for Pricing
View Details
CTRP3 Antibody
MBS9612391-02 0.2 mL

CTRP3 Antibody

Sign In for Pricing
View Details
CTRP3 Antibody
MBS9612391-03 5x 0.2 mL

CTRP3 Antibody

Sign In for Pricing
View Details
BACH1 Protein Lysate (Human) with C-Ha Tag
12974031 100 µg

BACH1 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
HSPA1L Antibody Blocking Peptide
orb1509589 500 µg

HSPA1L Antibody Blocking Peptide

Sign In for Pricing
View Details
Nav1.7-IN-2 10mM * 1mL in DMSO
A12185-10mM-D 10 mM x 1mL in DMSO

Nav1.7-IN-2 10mM * 1mL in DMSO

Sign In for Pricing
View Details