Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DNAJC25-GNG10 Rabbit Polyclonal Antibody (HRP)

DNAJC25-GNG10 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q9H1X3

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human LOC552891

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AGALVEGLYCGTRDCYEVLGVSRSAGKAEIARAYRQLARRYHPDRYRPQP

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

16kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_004116

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cnrip1 ORF Vector (Rat) (pORF)
16505016 1.0 µg DNA

Cnrip1 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
OSBPL1A Knockout Raji Polyclonal Cells
ARG1416 1 Million

OSBPL1A Knockout Raji Polyclonal Cells

Sign In for Pricing
View Details
Thermometer, Maximum and Minimum, Six’s, Without Shade
1140200/1A 1 Each

Thermometer, Maximum and Minimum, Six’s, Without Shade

Sign In for Pricing
View Details
Rabbit Anti-Mouse Interferon Inducible T-Cell Alpha Chemoattractant (ITaC) Polyclonal Antibody
VD3N841 1 Each

Rabbit Anti-Mouse Interferon Inducible T-Cell Alpha Chemoattractant (ITaC) Polyclonal Antibody

Sign In for Pricing
View Details
Porcine 17-OHP ELISA Kit
EPH0211 96 Tests

Porcine 17-OHP ELISA Kit

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Host Cell Factor C1 (HCFC1)
MBS2064010-01 0.1 mL

APC-Linked Polyclonal Antibody to Host Cell Factor C1 (HCFC1)

Sign In for Pricing
View Details