Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP2A1 Rabbit Polyclonal Antibody (HRP)

ATP2A1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ATP2A, SERCA1

UniProt

O14983

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence GTAIAICRRIGIFGENEEVADRAYTGREFDDLPLAEQREACRRACCFARV

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GTAIAICRRIGIFGENEEVADRAYTGREFDDLPLAEQREACRRACCFARV

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

110 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

NCBI Accession Number

NP_004311

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Annexin V-Elab Fluor® Violet 450 Azide-Free Lyophilized Powder
E-CK-A133U-01 25 µg

Annexin V-Elab Fluor® Violet 450 Azide-Free Lyophilized Powder

Sign In for Pricing
View Details
Annexin V-Elab Fluor® Violet 450 Azide-Free Lyophilized Powder
E-CK-A133U-02 100 µg

Annexin V-Elab Fluor® Violet 450 Azide-Free Lyophilized Powder

Sign In for Pricing
View Details
BHMT (NM_001713) Human Over-expression Lysate
LY400644 100 µg

BHMT (NM_001713) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human B7-H4/VTCN1 Protein (mFc Tag)
PKSH033756-01 10 µg

Recombinant Human B7-H4/VTCN1 Protein (mFc Tag)

Sign In for Pricing
View Details
Recombinant Human B7-H4/VTCN1 Protein (mFc Tag)
PKSH033756-02 50 µg

Recombinant Human B7-H4/VTCN1 Protein (mFc Tag)

Sign In for Pricing
View Details
CD3e (T-Cell Marker) (C3e/2478), CF488A conjugate, 0.1mg/mL
BNC882478-100 1x 100 µL

CD3e (T-Cell Marker) (C3e/2478), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details